Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR82 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 174-313 of human WDR82 (NP_079498.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WDR82 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 174-313 of human WDR82 (NP_079498.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04996A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR82 |
| Target Synonyms | SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047; WDR82 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, HepG2, Mouse brain, Mouse thymus, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 174-313 of human WDR82 (NP_079498.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD | Uniprot ID | Q6UXN9 |
Uniprot Id
Q6UXN9
Target Species
Human
Target Name
WDR82
Target Full Name
WD repeat-containing protein 82
Target Function
Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
Target Subcellular Location
Nucleus. Note=Associates with chromatin.
Target Protein Families
WD repeat SWD2 family
Target Synonyms
TMEM113; MST107; MSTP107; PRO2730; PRO34047; Protein TMEM113; Swd2; transmembrane protein 113; UNQ9342/PRO34047; WD repeat domain 82; WD repeat-containing protein 82; wdr82; WDR82_HUMAN; WDR82A
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
