-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WHRN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 708-907 of human WHRN (NP_056219.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WHRN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 708-907 of human WHRN (NP_056219.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01687A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WHRN |
| Target Synonyms | WI; CIP98; USH2D; DFNB31; PDZD7B; WHRN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 708-907 of human WHRN (NP_056219.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSGHPDQTGTNQHFVMVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAGEAEASAPGRGRQSVSTKSRSSKELPRNERPTDGANKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML | Uniprot ID | Q9P202 |
Uniprot Id
Q9P202
Target Species
Human
Target Name
WHRN
Target Full Name
Whirlin
Target Function
Involved in hearing and vision as member of the USH2 complex. Necessary for elongation and maintenance of inner and outer hair cell stereocilia in the organ of Corti in the inner ear. Involved in the maintenance of the hair bundle ankle region, which connects stereocilia in cochlear hair cells of the inner ear. In retina photoreceptors, required for the maintenance of periciliary membrane complex that seems to play a role in regulating intracellular protein transport.
Target Involvement
Deafness, autosomal recessive, 31 (DFNB31); Usher syndrome 2D (USH2D)
Target Subcellular Location
Cytoplasm. Cell projection, stereocilium. Cell projection, growth cone. Photoreceptor inner segment. Cell junction, synapse.
Target Synonyms
1110035G07Rik; Autosomal recessive deafness type 31 protein; CASK interacting protein CIP98; CIP 98; CIP98; Deafness autosomal recessive 31; DFNB 31; DKFZp434N014; KIAA1526; RP11 9M16.1; USH 2D; USH2D; Whirlin; WHRN; WHRN_HUMAN; WI
Target Background
This gene is thought to function in the organization and stabilization of sterocilia elongation and actin cystoskeletal assembly, based on studies of the related mouse gene. Mutations in this gene have been associated with autosomal recessive non-syndromic deafness and Usher Syndrome. Alternative splicing results in multiple transcript variants.
Notification