Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 307-377 of human WIF1 (NP_009122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 307-377 of human WIF1 (NP_009122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03806A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WIF1 |
| Target Synonyms | WIF-1; WIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 307-377 of human WIF1 (NP_009122.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNY | Uniprot ID | Q9Y5W5 |
Uniprot Id
Q9Y5W5
Target Species
Human
Target Name
WIF1
Target Full Name
Wnt inhibitory factor 1
Target Function
Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.
Target Subcellular Location
Secreted.
Target Synonyms
WIF-1; wif1; WIF1_HUMAN; Wnt inhibitory factor 1
Target Background
The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
