-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WISP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human WISP2 (NP_003872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WISP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human WISP2 (NP_003872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10332A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WISP2 |
| Target Synonyms | CT58; WISP2; CTGF-L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human WISP2 (NP_003872.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF | Uniprot ID | O76076 |
Uniprot Id
O76076
Target Species
Human
Target Name
CCN5
Target Full Name
CCN family member 5
Target Function
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Target Subcellular Location
Secreted.
Target Protein Families
CCN family
Target Tissue Specificity
Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
Target Research Area
Stem Cells
Target Synonyms
CCN family member 5; CCN5 ; Connective tissue growth factor like protein; Connective tissue growth factor related protein 58 ; Connective tissue growth factor-like protein; Connective tissue growth factor-related protein 58; CT58 ; CTGF L; CTGF-L; WISP 2; WISP-2; Wisp2; WISP2_HUMAN; Wnt 1 signaling pathway protein 2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2
Target Background
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.
Notification