-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WRAP53 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WRAP53 (NP_060551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WRAP53 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WRAP53 (NP_060551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07397A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WRAP53 |
| Target Synonyms | DKCB3; TCAB1; WDR79; WRAP53 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WRAP53 (NP_060551.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS | Uniprot ID | Q9BUR4 |
Uniprot Id
Q9BUR4
Target Species
Human
Target Name
WRAP53
Target Full Name
Telomerase Cajal body protein 1
Target Function
RNA chaperone that plays a key role in telomere maintenance and RNA localization to Cajal bodies. Specifically recognizes and binds the Cajal body box (CAB box) present in both small Cajal body RNAs (scaRNAs) and telomerase RNA template component (TERC). Essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex essential for the replication of chromosome termini that elongates telomeres in most eukaryotes. In the telomerase holoenzyme complex, required to stimulate the catalytic activity of the complex. Acts by specifically binding the CAB box of the TERC RNA and controlling the folding of the CR4/CR5 region of the TERC RNA, a critical step for telomerase activity. In addition, also controls telomerase holoenzyme complex localization to Cajal body. During S phase, required for delivery of TERC to telomeres during S phase and for telomerase activity. In addition to its role in telomere maintenance, also required for Cajal body formation, probably by mediating localization of scaRNAs to Cajal bodies. Also plays a role in DNA repair: phosphorylated by ATM in response to DNA damage and relocalizes to sites of DNA double-strand breaks to promote the repair of DNA double-strand breaks. Acts by recruiting the ubiquitin ligase RNF8 to DNA breaks and promote both homologous recombination (HR) and non-homologous end joining (NHEJ).
Target Involvement
Dyskeratosis congenita, autosomal recessive, 3 (DKCB3)
Target Subcellular Location
Nucleus, Cajal body. Chromosome, telomere. Chromosome.
Target Tissue Specificity
Expressed in all tissues and cell lines examined.
Target Synonyms
DKCB3; FLJ10385; TCAB1; Telomerase Cajal body protein 1; WAP53_HUMAN; WD repeat containing antisense to TP53; WD repeat containing protein 79; WD repeat-containing protein 79; WD40 repeat-containing protein encoding RNA antisense to p53; Wrap53
Target Background
This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene.
Notification