-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WSTF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WSTF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14100A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WSTF |
| Target Synonyms | WSTF; WBSCR9; WBSCR10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, PC-12, SH-SY5Y, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLE | Uniprot ID | Q9UIG0 |
Uniprot Id
Q9UIG0
Target Species
Human
Target Name
BAZ1B
Target Full Name
Tyrosine-protein kinase BAZ1B
Target Function
Atypical tyrosine-protein kinase that plays a central role in chromatin remodeling and acts as a transcription regulator. Involved in DNA damage response by phosphorylating 'Tyr-142' of histone H2AX (H2AXY142ph). H2AXY142ph plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Regulatory subunit of the ATP-dependent WICH-1 and WICH-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair. Both complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template. The WICH-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the WICH-5 ISWI chromatin remodeling complex. The WICH-5 ISWI chromatin-remodeling complex regulates the transcription of various genes, has a role in RNA polymerase I transcription. Within the B-WICH complex has a role in RNA polymerase III transcription. Mediates the recruitment of the WICH-5 ISWI chromatin remodeling complex to replication foci during DNA replication.
Target Involvement
BAZ1B is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of BAZ1B may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
Target Subcellular Location
Nucleus.
Target Protein Families
WAL family, BAZ1B subfamily
Target Tissue Specificity
Ubiquitously expressed with high levels of expression in heart, brain, placenta, skeletal muscle and ovary.
Target Synonyms
baz1b; BAZ1B_HUMAN; Bromodomain adjacent to zinc finger domain protein 1B; hWALP 2; hWALP-2; hWALP2; transcription factor WSTF; Tyrosine-protein kinase BAZ1B; WALP-2; WALP2; WBRS 9; WBRS-9; WBRS9; WBSC 10; WBSC-10; WBSC10; WBSCR10; WBSCR9; Williams Beuren syndrome chromosome region 9 protein; Williams syndrome transcription factor; Williams-Beuren syndrome chromosomal region 10 protein; Williams-Beuren syndrome chromosomal region 9 protein; WSTF
Target Background
This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
Notification