Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WWC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-426 of human WWC1 (NP_056053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WWC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-426 of human WWC1 (NP_056053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11438A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WWC1 |
| Target Synonyms | KIBRA; HBEBP3; HBEBP36; MEMRYQTL; PPP1R168; WWC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-426 of human WWC1 (NP_056053.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGINSNNQLAEKVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPRKWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLHSQLKSL | Uniprot ID | Q8IX03 |
Uniprot Id
Q8IX03
Target Species
Human
Target Name
WWC1
Target Full Name
Protein KIBRA
Target Function
Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with NF2 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. Acts as a transcriptional coactivator of ESR1 which plays an essential role in DYNLL1-mediated ESR1 transactivation. Regulates collagen-stimulated activation of the ERK/MAPK cascade. Modulates directional migration of podocytes. Acts as a substrate for PRKCZ. Plays a role in cognition and memory performance
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Nucleus. Cell projection, ruffle membrane. Note=Colocalizes with PRKCZ in the perinuclear region.
Target Protein Families
WWC family, KIBRA subfamily
Target Tissue Specificity
Expressed in mammary epithelial cells and breast cancer cell lines. Found in the luminal epithelium surrounding the ducts in the normal breast. In the brain, expressed in somatodendritic compartment of neurons in the cortex and hippocampus and in the cere
Target Synonyms
WWC1; KIAA0869; Protein KIBRA; HBeAg-binding protein 3; Kidney and brain protein; KIBRA; WW domain-containing protein 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
