-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XPNPEP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-230 of human XPNPEP3 (NP_071381.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XPNPEP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-230 of human XPNPEP3 (NP_071381.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08191A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XPNPEP3 |
| Target Synonyms | XPNPEP3; APP3; ICP55; NPHPL1; X-prolyl aminopeptidase 3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 32-230 of human XPNPEP3 (NP_071381.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSK | Uniprot ID | Q9NQH7 |
Uniprot Id
Q9NQH7
Target Species
Human
Target Name
XPNPEP3
Target Full Name
Xaa-Pro aminopeptidase 3
Target Function
Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Leu-Pro-Ala. Also shows low activity towards peptides with Ala or Ser at the P1 position.; Promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, suggesting a function as an adapter protein for TNFRSF1B; the effect is independent of XPNPEP3 peptidase activity. May inhibit apoptotic cell death induced via TNF-TNFRSF1B signaling.
Target Involvement
Nephronophthisis-like nephropathy 1 (NPHPL1)
Target Subcellular Location
[Isoform 1]: Mitochondrion. Cytoplasm.; [Isoform 2]: Cytoplasm.
Target Protein Families
Peptidase M24B family
Target Tissue Specificity
Isoform 1 and isoform 2 are widely expressed, with isoform 1 being more abundant.
Target Synonyms
Aminopeptidase P3; APP3; NPHPL1; OTTHUMP00000199806; Probable Xaa Pro aminopeptidase 3; Probable Xaa-Pro aminopeptidase 3; X Pro aminopeptidase 3; X prolyl aminopeptidase (aminopeptidase P) 3; X-Pro aminopeptidase 3; XPNPEP3; XPP3_HUMAN
Target Background
The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.
Notification