Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XPO6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 116-216 of human XPO6 (NP_055986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XPO6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 116-216 of human XPO6 (NP_055986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using XPO6 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-08227A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XPO6 |
| Target Synonyms | XPO6; EXP6; RANBP20; exportin-6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F, Mouse testis, Mouse thymus, OVCAR-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 116-216 of human XPO6 (NP_055986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIGRQDWPMFYHDFFTNILQLIQSPVTTPLGLIMLKTTSEELACPREDLSVARKEELRKLLLDQVQTVLGLLTGILETVWDKHSVTAATPPPSPTSGESGD | Uniprot ID | Q96QU8 |
Uniprot Id
Q96QU8
Target Species
Human
Target Name
XPO6
Target Full Name
Exportin-6
Target Function
Mediates the nuclear export of actin and profilin-actin complexes in somatic cells.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Exportin family
Target Synonyms
Exp6; Exportin 6; Exportin-6; RAN binding protein 20; Ran-binding protein 20; RANBP20; xpo6; XPO6_HUMAN
Target Background
The protein encoded by this gene is a member of the importin-beta family. Members of this family are regulated by the GTPase Ran to mediate transport of cargo across the nuclear envelope. This protein has been shown to mediate nuclear export of profilin-actin complexes. A pseudogene of this gene is located on the long arm of chromosome 14. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
