Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XPOT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human XPOT (NP_009166.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XPOT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human XPOT (NP_009166.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XPOT |
| Target Synonyms | XPO3; XPOT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, B cells, Mouse brain, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human XPOT (NP_009166.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSE | Uniprot ID | O43592 |
Uniprot Id
O43592
Target Species
Human
Target Name
XPOT
Target Full Name
Exportin-T
Target Function
Mediates the nuclear export of aminoacylated tRNAs. In the nucleus binds to tRNA and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the tRNA from the export receptor. XPOT then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus
Target Subcellular Location
Nucleus. Cytoplasm. Note=Nuclear, once bound to tRNA and Ran the complex translocates to the cytoplasm. Shuttles between the nucleus and the cytoplasm.
Target Protein Families
Exportin family
Target Synonyms
1110004L07Rik; 3110065H13Rik; AI452076; C79645; Exportin tRNA; Exportin(tRNA); Exportin-T; Nuclear export receptor for tRNAs; tRNA exportin; XPO3; xpot; XPOT_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
