-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XRCC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human XRCC1 (P18887) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XRCC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human XRCC1 (P18887) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13831A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XRCC1 |
| Target Synonyms | RCC; SCAR26; XRCC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human XRCC1 (P18887). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESR | Uniprot ID | P18887 |
Uniprot Id
P18887
Target Species
Human
Target Name
XRCC1
Target Full Name
DNA repair protein XRCC1
Target Function
Involved in DNA single-strand break repair by mediating the assembly of DNA break repair protein complexes. Probably during DNA repair, negatively regulates ADP-ribose levels by modulating ADP-ribosyltransferase PARP1 activity.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 26 (SCAR26)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in fibroblasts, retinal pigmented epithelial cells and lymphoblastoid cells (at protein level).
Target Synonyms
DNA repair protein XRCC1; RCC; X ray repair complementing defective repair in chinese hamster; X ray Repair Complementing Defective Repair in Chinese Hamster Cells; X ray repair complementing defective repair in chinese hamster cells 1; X ray repair cross complementing 1; X ray repair cross complementing protein 1; X ray repair; complementing defective; repair in Chinese hamster; X-ray repair cross-complementing protein 1; XRCC 1; Xrcc1; XRCC1_HUMAN
Target Background
The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
Notification