-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YB-1/YBX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human YB-1/YBX1 (NP_004550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against YB-1/YBX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human YB-1/YBX1 (NP_004550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YB-1/YBX1 |
| Target Synonyms | YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1; YB-1/YBX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human YB-1/YBX1 (NP_004550.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVI | Uniprot ID | P67809 |
Uniprot Id
P67809
Target Species
Human
Target Name
YBX1
Target Full Name
Y-box-binding protein 1
Target Function
DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation. Predominantly acts as a RNA-binding protein: binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C). Promotes mRNA stabilization: acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. Component of the CRD-mediated complex that promotes MYC mRNA stability. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs. Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs. Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence: acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs. Also involved in pre-mRNA alternative splicing regulation: binds to splice sites in pre-mRNA and regulates splice site selection. Also able to bind DNA: regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasmic granule. Secreted. Secreted, extracellular exosome.
Target Research Area
Others
Target Synonyms
BP 8; CBF-A; CCAAT binding transcription factor I subunit A; CCAAT-binding transcription factor I subunit A; CSDA2; CSDB; DBPB; DNA binding protein B; DNA-binding protein B; EFI-A; Enhancer factor I subunit A; MDR NF1; MGC104858; MGC110976; MGC117250; NSEP 1; NSEP1; Nuclease sensitive element binding protein 1; Nuclease-sensitive element-binding protein 1; p50; Q15905; Y-box binding protein 1; Y-box transcription factor; Y-box-binding protein 1; YB 1; YB-1; YBOX1_HUMAN; YBX 1; ybx1
Target Background
This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes.
Notification