Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YPEL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human YPEL3 (NP_001138996.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against YPEL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human YPEL3 (NP_001138996.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08721A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YPEL3 |
| Target Synonyms | YPEL3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human YPEL3 (NP_001138996.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD | Uniprot ID | P61236 |
Uniprot Id
P61236
Target Species
Human
Target Name
YPEL3
Target Full Name
Protein yippee-like 3
Target Function
Involved in proliferation and apoptosis in myeloid precursor cells.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Yippee family
Target Tissue Specificity
Widely expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Protein yippee-like 3; Small ubiquitinated apoptotic protein; Yippee like 3; Yippee-like 3 (Drosophila); Ypel3; YPEL3_HUMAN
Target Background
Predicted to enable metal ion binding activity. Involved in positive regulation of cellular senescence. Predicted to be located in nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
