Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZC3H12D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ZC3H12D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZC3H12D |
| Target Synonyms | TFL; p34; MCPIP4; C6orf95; dJ281H8.1; ZC3H12D | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse spleen, Rat spleen, THP-1, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP | Uniprot ID | A2A288 |
Uniprot Id
A2A288
Target Species
Human
Target Name
ZC3H12D
Target Full Name
Probable ribonuclease ZC3H12D
Target Function
May regulate cell growth likely by suppressing RB1 phosphorylation. May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages. Serve as a tumor suppressor in certain leukemia cells. Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation.
Target Involvement
A chromosomal aberration involving ZC3H12D may be the cause of the transformation of follicular lymphoma (FL) to diffuse large B-cell lymphoma (DLBCL). Translocation t(2;6)(p12;q25) with IGK. Resulting protein may not be expressed.
Target Subcellular Location
Cytoplasm, P-body.; [Isoform 1]: Cytoplasm. Note=Localized as discrete granules. Colocalized with mRNA-processing body markers, AGO2 and DCP1A, but not with a stress granule maker, TIA1, in the cytoplasm.; [Isoform 3]: Cytoplasm. Nucleus.
Target Protein Families
ZC3H12 family
Target Tissue Specificity
Expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.
Target Synonyms
C6orf95; ZC3H12D; FLJ00361; FLJ46041; MCP induced protein 4; MCP-induced protein 4; MCPIP4; p34; Probable ribonuclease ZC3H12D; TFL; Transformed follicular lymphoma; Tumor suppressor TFL; ZC12D_HUMAN; ZC3H12D; Zinc finger CCCH domain containing protein 12D; Zinc finger CCCH domain-containing protein 12D
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
