Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-331 of human ZDHHC15 (NP_659406.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-331 of human ZDHHC15 (NP_659406.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZDHHC15 Rabbit pAb, using ZDHHC15 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-08299A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC15 |
| Target Synonyms | ZDHHC15; DHHC15; MRX91; palmitoyltransferase ZDHHC15 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, 293T-ZDHHC15-His(C) | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 231-331 of human ZDHHC15 (NP_659406.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET | Uniprot ID | Q96MV8 |
Uniprot Id
Q96MV8
Target Species
Human
Target Name
ZDHHC15
Target Full Name
Palmitoyltransferase ZDHHC15
Target Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates. Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA. Palmitoylates IGF2R and SORT1, promoting their partitioning to an endosomal membrane subdomain where they can interact with the retromer cargo-selective complex. Thereby, regulates retrograde transport from endosomes to the Golgi apparatus of these lysosomal sorting receptors and plays a role in trafficking of lysosomal proteins. In the nervous system, catalyzes the palmitoylation of DLG4/PSD95 and regulates its synaptic clustering and function in synaptogenesis. Could be involved in the differentiation of dopaminergic neurons and the development of the diencephalon. Could also catalyze the palmitoylation of GAP43. Could also palmitoylate DNAJC5 and regulate its localization to the Golgi membrane. Could also palmitoylate FYN as shown in vitro.
Target Involvement
Mental retardation, X-linked 91 (MRX91)
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic density.
Target Protein Families
DHHC palmitoyltransferase family
Target Tissue Specificity
Expressed in placenta, liver, lung, kidney, heart and brain.
Target Synonyms
ZDHHC15; UNQ1969/PRO4501; Palmitoyltransferase ZDHHC15; Acyltransferase ZDHHC15; Zinc finger DHHC domain-containing protein 15; DHHC-15
Target Background
The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
