Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 270-365 of human ZDHHC20 (NP_001316988.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 270-365 of human ZDHHC20 (NP_001316988.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07182A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC20 |
| Target Synonyms | DHHC20; DHHC-20; 4933421L13Rik; ZDHHC20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, MCF7, Mouse brain, Mouse lung, Mouse testis, Rat lung, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 270-365 of human ZDHHC20 (NP_001316988.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN | Uniprot ID | Q5W0Z9 |
Uniprot Id
Q5W0Z9
Target Species
Human
Target Name
ZDHHC20
Target Full Name
Palmitoyltransferase ZDHHC20
Target Function
Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. Catalyzes palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, and modulates the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation. Has a preference for acyl-CoA with C16 fatty acid chains. Can also utilize acyl-CoA with C14 and C18 fatty acid chains.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Target Protein Families
DHHC palmitoyltransferase family
Target Synonyms
ZDHHC20; Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; DHHC domain-containing cysteine-rich protein 20; DHHC20; Zinc finger DHHC domain-containing protein 20
Target Background
Enables protein-cysteine S-palmitoyltransferase activity and zinc ion binding activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in intracellular membrane-bounded organelle and plasma membrane. Is integral component of Golgi membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
