Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human ZDHHC4 (NP_060576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human ZDHHC4 (NP_060576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07184A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC4 |
| Target Synonyms | ZNF374; ZDHHC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 110-210 of human ZDHHC4 (NP_060576.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VNLFFFTLTCGTNPGIITKANELLFLHVYEFDEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI | Uniprot ID | Q9NPG8 |
Uniprot Id
Q9NPG8
Target Species
Human
Target Name
ZDHHC4
Target Full Name
Palmitoyltransferase ZDHHC4
Target Function
Palmitoyltransferase that could catalyze the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
DHHC palmitoyltransferase family
Target Synonyms
1810021D01Rik; 2900029I10Rik; DC1; DHHC 4; DHHC-4; FLJ10479; MGC108810; OTTHUMP00000025197; OTTHUMP00000115925; OTTHUMP00000115926; OTTMUSP00000026321; OTTMUSP00000026322; Probable palmitoyltransferase ZDHHC4; ZDHC4_HUMAN; ZDHHC4; Zinc finger DHHC domain containing protein 4; Zinc finger DHHC domain-containing protein 4; Zinc finger protein 374; ZNF374
Target Background
Predicted to enable protein-cysteine S-palmitoyltransferase activity. Predicted to be involved in peptidyl-L-cysteine S-palmitoylation and protein targeting to membrane. Located in Golgi apparatus and endoplasmic reticulum.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
