-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZEB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZEB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16522A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZEB1 |
| Target Synonyms | BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; ZEB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE | Uniprot ID | P37275 |
Uniprot Id
P37275
Target Species
Human
Target Name
ZEB1
Target Full Name
Zinc finger E-box-binding homeobox 1
Target Function
Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
Target Involvement
Corneal dystrophy, posterior polymorphous, 3 (PPCD3); Corneal dystrophy, Fuchs endothelial, 6 (FECD6)
Target Subcellular Location
Nucleus.
Target Protein Families
Delta-EF1/ZFH-1 C2H2-type zinc-finger family
Target Tissue Specificity
Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed in heart and skelet
Target Synonyms
AREB 6; AREB6; BZP; Delta crystallin enhancer binding factor 1; DELTA EF1; FECD6; MGC133261; Negative regulator of IL 2; Negative regulator of IL2; NIL 2 A; NIL 2 A zinc finger protein; NIL 2A; NIL-2-A zinc finger protein; NIL2A; Posterior polymorphous corneal dystrophy 3; PPCD3; Represses interleukin 2 expression; TCF 8; TCF-8; TCF8; Transcription factor 8 (represses interleukin 2 expression); Transcription factor 8; ZEB 1; ZEB; ZEB1; ZEB1_HUMAN; ZFHEP; ZFHX 1A; ZFHX1A; Zinc finger E box binding homeobox 1; Zinc finger E-box-binding homeobox 1; Zinc finger homeodomain enhancer binding protein
Target Background
This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification