Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZGPAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-272 of human ZGPAT (NP_115916.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZGPAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-272 of human ZGPAT (NP_115916.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00189A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZGPAT |
| Target Synonyms | ZIP; ZC3H9; GPATC6; GPATCH6; ZC3HDC9; KIAA1847; ZGPAT | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 213-272 of human ZGPAT (NP_115916.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTE | Uniprot ID | Q8N5A5 |
Uniprot Id
Q8N5A5
Target Species
Human
Target Name
ZGPAT
Target Full Name
Zinc finger CCCH-type with G patch domain-containing protein
Target Function
Transcription repressor that specifically binds the 5'-GGAGAntagonizes the transcription repression by isoform 1 by competing for the binding of the NuRD complex. Does not bind DNA.
Target Subcellular Location
Nucleus.; [Isoform 4]: Nucleus.
Target Tissue Specificity
Widely expressed.
Target Synonyms
ZGPAT; GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP; Zinc finger CCCH-type with G patch domain-containing protein; G patch domain-containing protein 6; Zinc finger CCCH domain-containing protein 9; Zinc finger and G patch domain-containing protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
