Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Zip12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Zip12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10021A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Zip12 |
| Target Synonyms | ZIP12; ZIP-12; LZT-Hs8; bA570F3.1; Zip12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse eye, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG | Uniprot ID | Q504Y0 |
Uniprot Id
Q504Y0
Target Species
Human
Target Name
SLC39A12
Target Full Name
Zinc transporter ZIP12
Target Function
Acts as a zinc-influx transporter (Potential). May be partly involved in the outbreak of schizophrenia.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
ZIP transporter (TC 2.A.5) family
Target Tissue Specificity
Expressed in brain and eye.
Target Synonyms
bA570F3.1; FLJ30499; LIV 1 subfamily of ZIP zinc transporter 8; LIV-1 subfamily of ZIP zinc transporter 8; LZT Hs8; LZT-Hs8; LZTHs8; MGC43205; MGC51099; S39AC_HUMAN; SLC39A12; Solute carrier family 39 (metal ion transporter) member 12; Solute carrier family 39 (zinc transporter) member 12; Solute carrier family 39 member 12; Zinc transporter ZIP12; ZIP 12; ZIP-12; ZIP12; Zrt and Irt like protein 12; Zrt- and Irt-like protein 12
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
