Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZMIZ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZMIZ2 (NP_001287888) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZMIZ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZMIZ2 (NP_001287888) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08816A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZMIZ2 |
| Target Synonyms | NET27; ZIMP7; hZIMP7; TRAFIP20; ZMIZ2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Jurkat, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZMIZ2 (NP_001287888). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQCLGQQAFAEGGANKGYVQQGVYSRGGYPGAPGFTTGYAGGPGGLGLPSHAARPST | Uniprot ID | Q8NF64 |
Uniprot Id
Q8NF64
Target Species
Human
Target Name
ZMIZ2
Target Full Name
Zinc finger MIZ domain-containing protein 2
Target Function
Increases ligand-dependent transcriptional activity of AR and other nuclear hormone receptors.
Target Subcellular Location
Nucleus. Note=Detected at replication foci throughout S phase.
Target Tissue Specificity
Expressed most abundantly in testis with lower levels in heart, brain, pancreas, prostate and ovary.
Target Synonyms
2410117E06Rik; D11Bwg0280e; DKFZp761I2123; hZIMP7; KIAA1886; PIAS like protein Zimp7; PIAS-like protein Zimp7; R74931; RGD1309256; RP23-198N14.8; ZIMP7; Zinc finger MIZ domain containing protein 2; Zinc finger MIZ domain-containing protein 2; Zinc finger MIZ type containing 2; zinc finger; MIZ-type containing 2; zinc finger; MIZtype containing2; ZMIZ 2; Zmiz2; ZMIZ2_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
