-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF259 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ZNF259 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13422A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF259 |
| Target Synonyms | GKAF; ZNF259 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR | Uniprot ID | O75312 |
Uniprot Id
O75312
Target Species
Human
Target Name
ZPR1
Target Full Name
Zinc finger protein ZPR1
Target Function
Acts as a signaling molecule that communicates proliferative growth signals from the cytoplasm to the nucleus. Plays a role for the localization and accumulation of the survival motor neuron protein SMN1 in sub-nuclear bodies, including gems and Cajal bodies. Induces neuron differentiation and stimulates axonal growth and formation of growth cone in spinal cord motor neurons. Plays a role in the splicing of cellular pre-mRNAs. May be involved in H(2)O(2)-induced neuronal cell death.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Nucleus, gem. Nucleus, Cajal body. Cytoplasm, perinuclear region. Cytoplasm. Cell projection, axon. Cell projection, growth cone.
Target Protein Families
ZPR1 family
Target Tissue Specificity
Expressed in fibroblast; weakly expressed in fibroblast of spinal muscular atrophy (SMA) patients.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
MGC110983; Zinc finger protein 259; Zinc finger protein ZPR1; ZNF 259; ZNF259; ZPR1; ZPR1_HUMAN
Target Background
The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene.
Notification