Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF460 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-210 of human ZNF460 (NP_006626.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF460 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-210 of human ZNF460 (NP_006626.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06977A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF460 |
| Target Synonyms | HZF8; ZNF272; ZNF460 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Rat liver, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-210 of human ZNF460 (NP_006626.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEMQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKH | Uniprot ID | Q14592 |
Uniprot Id
Q14592
Target Species
Human
Target Name
ZNF460
Target Full Name
Zinc finger protein 460
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitously expressed at low levels. Highest levels are found in pancreas and liver.
Target Synonyms
HZF 8; HZF8; Zinc finger protein 272; Zinc finger protein 460; Zinc finger protein HZF8; ZN460_HUMAN; ZNF 272; ZNF 460; ZNF272; ZNF460
Target Background
Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
