Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF645 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF645 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07317A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF645 |
| Target Synonyms | CT138; HAKAIL; ZNF645 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY | Uniprot ID | Q8N7E2 |
Uniprot Id
Q8N7E2
Target Species
Human
Target Name
CBLL2
Target Full Name
E3 ubiquitin-protein ligase CBLL2
Target Function
E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. May operate on tyrosine-phosphorylated SRC substrates.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Exclusively expressed in testis and sperm, including spermatocytes, round and elongated spermatids, and Leydig cells.
Target Synonyms
CBLL2; ZNF645E3 ubiquitin-protein ligase CBLL2; EC 2.3.2.27; Cbl proto-oncogene-like protein 2; RING-type E3 ubiquitin transferase ZNF645; Zinc finger protein 645; c-Cbl-like protein 2
Target Background
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
