-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF703 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-290 of human ZNF703 (NP_079345.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ZNF703 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-290 of human ZNF703 (NP_079345.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05717A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF703 |
| Target Synonyms | NLZ1; ZPO1; ZEPPO1; ZNF503L; ZNF703 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-290 of human ZNF703 (NP_079345.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGA | Uniprot ID | Q9H7S9 |
Uniprot Id
Q9H7S9
Target Species
Human
Target Name
ZNF703
Target Full Name
Zinc finger protein 703
Target Function
Transcriptional corepressor which does not bind directly to DNA and may regulate transcription through recruitment of histone deacetylases to gene promoters. Regulates cell adhesion, migration and proliferation. May be required for segmental gene expression during hindbrain development.
Target Involvement
Luminal B breast cancers are the clinically more aggressive estrogen receptor-positive tumors. Amplification of a distal 8p12 locus occurs in around one third of the cases and ZNF703 is the single gene within the minimal amplicon. Amplification of the gene correlates with its protein expression in tumor cells. ZNF703 is a classical breast cancer oncogene since it is able to transform non-malignant cells and increase cellular proliferation.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Elbow/Noc family
Target Tissue Specificity
Expressed in mammary epithelium.
Target Synonyms
FLJ14299; ZEPPO1; Zinc finger elbow-related proline domain protein 1; Zinc finger protein 703; ZN703_HUMAN; ZNF503L; znf703; ZPO1
Target Background
Predicted to enable DNA-binding transcription factor binding activity. Involved in several processes, including cellular response to estradiol stimulus; mammary gland epithelial cell differentiation; and positive regulation of mammary gland epithelial cell proliferation. Located in cytoplasm and nuclear matrix. Part of protein-containing complex.
Notification