Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF711 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZNF711 (NP_001317503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF711 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZNF711 (NP_001317503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04349A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF711 |
| Target Synonyms | ZNF4; ZNF5; ZNF6; CMPX1; MRX65; MRX97; XLID97; Zfp711; dJ75N13.1; ZNF711 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZNF711 (NP_001317503.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEDYLMISLDDVGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVLDQSRMQREKMVYMAVKDSSQ | Uniprot ID | Q9Y462 |
Uniprot Id
Q9Y462
Target Species
Human
Target Name
ZNF711
Target Full Name
Zinc finger protein 711
Target Function
Transcription regulator required for brain development. Probably acts as a transcription factor that binds to the promoter of target genes and recruits PHF8 histone demethylase, leading to activate expression of genes involved in neuron development, such as KDM5C.
Target Involvement
Mental retardation, X-linked 97 (MRX97)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in neural tissues.
Target Synonyms
CMPX1; dJ75N13.1; MRX97; Zfp711; Zinc finger protein 6 (CMPX1); Zinc finger protein 6; Zinc finger protein 711; ZN711; ZN711_HUMAN; ZNF4; ZNF5; ZNF6; ZNF711
Target Background
This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with cognitive disability.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
