Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZPBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ZPBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06980A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZPBP |
| Target Synonyms | ZPBP1; SPGF66; ZPBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLVRLPRAFRLTKDSVKIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSK | Uniprot ID | Q9BS86 |
Uniprot Id
Q9BS86
Target Species
Human
Target Name
ZPBP
Target Full Name
Zona pellucida-binding protein 1
Target Function
Plays a role in acrosome compaction and sperm morphogenesis. Is implicated in sperm-oocyte interaction during fertilization.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Peripheral membrane protein. Secreted.
Target Protein Families
Zona pellucida-binding protein Sp38 family
Target Tissue Specificity
Expressed specifically in testis.
Target Synonyms
ZPBP; ZPBP1Zona pellucida-binding protein 1; Inner acrosomal membrane IAM38; Sp38
Target Background
ZPBP is one of several proteins that are thought to participate in secondary binding between acrosome-reacted sperm and the egg-specific extracellular matrix, the zona pellucida (McLeskey et al., 1998 [PubMed 9378618]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
