-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Zyxin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Zyxin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14122A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Zyxin |
| Target Synonyms | ESP-2; HED-2; Zyxin | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP | Uniprot ID | Q15942 |
Uniprot Id
Q15942
Target Species
Human
Target Name
ZYX
Target Full Name
Zyxin
Target Function
Adhesion plaque protein. Binds alpha-actinin and the CRP protein. Important for targeting TES and ENA/VASP family members to focal adhesions and for the formation of actin-rich structures. May be a component of a signal transduction pathway that mediates adhesion-stimulated changes in gene expression.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Cell junction, focal adhesion. Note=Associates with the actin cytoskeleton near the adhesion plaques. Enters the nucleus in the presence of HESX1.
Target Protein Families
Zyxin/ajuba family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ZYX; Zyxin; Zyxin-2
Target Background
Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.
Notification