Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Med25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Med25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07164A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED25 |
| Target Synonyms | F2J7.4; F2J7_4; MED25; mediator 25; PHYTOCHROME AND FLOWERING TIME 1; Med25 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Rosette leaf, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3). | Immunogen Sequence | AGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTV |
|---|---|---|---|
| Uniprot ID | Q7XYY2 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
