Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASC/TMS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of mouse ASC/TMS1 (NP_075747.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ASC/TMS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of mouse ASC/TMS1 (NP_075747.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07464A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASC/TMS1 |
| Target Synonyms | Asc; TNS1; masc; CARD5; TMS-1; 9130417A21Rik; ASC/TMS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus, Rat spleen, Rat thymus, THP-1, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of mouse ASC/TMS1 (NP_075747.3). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYGLELTMTVLRDMGLQELAEQLQTTKEESG | Uniprot ID | Q9EPB4 |
Uniprot Id
Q9EPB4
Target Synonyms
Asc; TNS1; masc; CARD5; TMS-1; 9130417A21Rik; ASC/TMS1
Target Background
Enables identical protein binding activity and protein dimerization activity. Involved in several processes, including activation of cysteine-type endopeptidase activity; positive regulation of cytokine production; and regulation of defense response. Acts upstream of or within several processes, including defense response to Gram-positive bacterium; positive regulation of macromolecule metabolic process; and regulation of autophagy. Located in cytosol; extracellular region; and nucleus. Part of inflammasome complex. Is expressed in several structures, including alimentary system; brain; heart; hemolymphoid system gland; and urinary system. Orthologous to human PYCARD (PYD and CARD domain containing).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
