Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Bak was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Bak(NP_031549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against Bak was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Bak(NP_031549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?paraffin-embedded Human colon tissue using?Bak Rabbit pAb(A25421) at?a?dilution of?1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.?Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Cat.No | ADA-08536A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Bak |
| Target Synonyms | Bak; N-Bak; N-BAK1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Bak(NP_031549.2) | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQP | Uniprot ID | O08734 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
