-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD74 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-215 of mouse CD74 (NP_034675.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD74 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-215 of mouse CD74 (NP_034675.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08210A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD74 |
| Target Synonyms | Ii; CLIP; DHLAG; HLADG; Ia-GAMMA; CD74 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 56-215 of mouse CD74 (NP_034675.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL | Uniprot ID | P04441-2 |
Uniprot Id
P04441
Target Species
Mouse
Target Name
CD74
Target Full Name
H-2 class II histocompatibility antigen gamma chain
Target Function
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs).; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.
Target Subcellular Location
[Isoform Long]: Late endosome. Lysosome.; Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome.
Target Tissue Specificity
[Isoform Long]: Expressed in thymus and lymph noodes. Expressed by antigen-presenting cells (APCs).; [Isoform Short]: Expressed in thymus and lymph noodes.
Target Synonyms
Ii; CLIP; DHLAG; HLADG; Ia-GAMMA; CD74
Target Background
Enables MHC class II protein binding activity; cytokine receptor activity; and nitric-oxide synthase binding activity. Contributes to cytokine binding activity. Involved in several processes, including macrophage migration inhibitory factor signaling pathway; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Acts upstream of or within several processes, including antigen processing and presentation of exogenous peptide antigen via MHC class II; regulation of T cell differentiation; and thymic T cell selection. Located in several cellular components, including Golgi apparatus; external side of plasma membrane; and multivesicular body. Part of MHC class II protein complex; NOS2-CD74 complex; and macrophage migration inhibitory factor receptor complex. Is expressed in lower jaw; lower jaw incisor; lower jaw molar; and thymus primordium. Orthologous to human CD74 (CD74 molecule).
Notification