Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD8A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 148-247 of mouse CD8A(NP_001074579.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD8A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 148-247 of mouse CD8A(NP_001074579.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16389A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD8A |
| Target Synonyms | Ly-2; Ly-B; Ly-35; Lyt-2; CD8A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain(Negative control), Mouse spleen, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 148-247 of mouse CD8A(NP_001074579.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | KVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV | Uniprot ID | P01731 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
