Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXO3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FOXO3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13028A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXO3A |
| Target Synonyms | Fkhr2; FKHRL1; Foxo3a; 1110048B16Rik; 2010203A17Rik; FOXO3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, PC-3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD | Uniprot ID | Q9WVH4 |
Uniprot Id
Q9WVH4
Target Synonyms
Fkhr2; FKHRL1; Foxo3a; 1110048B16Rik; 2010203A17Rik; FOXO3A
Target Background
Enables DNA binding activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription; positive regulation of muscle atrophy; and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand; female gonad development; and neuronal stem cell population maintenance. Located in cytosol; mitochondrial outer membrane; and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
