Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLI2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 327-442 of mouse GLI2(NP_001074594.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against GLI2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 327-442 of mouse GLI2(NP_001074594.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?Hep G2 cells using?GLI2 Rabbit pAb(A25103) at?a?dilution of?1:150 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.?Blue: DAPI for nuclear staining.
| Cat.No | ADA-08406A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLI2 |
| Target Synonyms | GLI2; CJS; HPE9; PHS2; THP1; THP2; Gli2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 327-442 of mouse GLI2(NP_001074594.1?). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | LTSISTMPTQLSSSSSNCLNDANQNKQNSESAVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCHWADCTKEYDTQEQLVHHINNEH | Uniprot ID | Q0VGT2 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
