Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAdCAM-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-109 of mouse MAdCAM-1 (NP_038619.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAdCAM-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-109 of mouse MAdCAM-1 (NP_038619.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse small intestine, using MAdCAM-1 Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-08209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAdCAM-1 |
| Target Synonyms | MAdCAM-1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-109 of mouse MAdCAM-1 (NP_038619.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY | Uniprot ID | Q61826 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
