Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p19ARF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p19ARF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of 293F, using p19ARF Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
| Cat.No | ADA-08219A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p19ARF |
| Target Synonyms | Arf; p16; MTS1; Pctr1; p19ARF; p16INK4a; p19; ARF-INK4a; INK4a-ARF; Ink4a/Arf; p16(INK4a) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA | Uniprot ID | Q64364 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
