Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Slc31a2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Slc31a2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08748A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC31A2 |
| Target Synonyms | CTR2; Slc31a2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI | Uniprot ID | O15432 |
Uniprot Id
O15432
Target Species
Human
Target Name
SLC31A2
Target Full Name
Protein SLC31A2
Target Function
Involved in low-affinity copper uptake.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
SLC31A2; COPT2; CTR2; Probable low affinity copper uptake protein 2; Copper transporter 2; hCTR2; Solute carrier family 31 member 2
Target Background
Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome; membrane; and recycling endosome. Is expressed in brain; retina nuclear layer; and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
