Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR33 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse WDR33 (NP_001164437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WDR33 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse WDR33 (NP_001164437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00967A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR33 |
| Target Synonyms | NET14; WDC146; WDR33 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, MCF7, Mouse testis, Mouse thymus, Rat testis, Rat thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse WDR33 (NP_001164437.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | AHKEAIREARFIHNIPFSVVPIVMVKLLSKCILGAKMHGLSQILGNFLHLMNTIFLFVFTHSPFCWHLSEVVLSWYQPLQYVRDVLSATFCTGFLFHLWLI | Uniprot ID | Q9C0J8 |
Uniprot Id
Q9C0J8
Target Species
Human
Target Name
WDR33
Target Full Name
pre-mRNA 3' end processing protein WDR33
Target Function
Essential for both cleavage and polyadenylation of pre-mRNA 3' ends.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Most highly expressed in testis.
Target Synonyms
WD repeat containing protein 33; WD repeat domain 33; WD repeat-containing protein 33; WD repeat-containing protein WDC146; WDC146; WDR 33; WDR33; WDR33_HUMAN
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
