Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PENK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-267 of human PENK(NP_001129162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PENK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-267 of human PENK(NP_001129162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08549A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PENK |
| Target Synonyms | PE; PENK-A; Proenkephalin-A | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-267 of human PENK(NP_001129162.1). | Immunogen Sequence | LANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF |
|---|---|---|---|
| Uniprot ID | P01210 |
Uniprot Id
P01210
Target Species
Human
Target Name
PENK
Target Full Name
Proenkephalin-A
Target Function
Competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.; Competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.; Increases glutamate release in the striatum and decreases GABA concentration in the striatum.; Increases glutamate release in the striatum.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule lumen. Secreted.
Target Protein Families
Opioid neuropeptide precursor family
Target Synonyms
Leu-enkephalin; Met-enkephalin; Met-enkephalin-Arg-Gly-Leu; Met-enkephalin-Arg-Phe; Methionine enkephalin; OGF; Opioid growth factor; PENK; PENK(114-133); PENK(143-183); PENK(237-258); PENK_HUMAN; PPA; Proenkephalin A; Proenkephalin; Proenkephalin-A; Synenkephalin
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
