Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLC gamma 2 (PLCG2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 701-800 of PLC gamma 2 (PLCG2) (NP_002652.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLC gamma 2 (PLCG2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 701-800 of PLC gamma 2 (PLCG2) (NP_002652.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from RAW 264.7 cells using PLC gamma 2 (PLCG2) Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-15642A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLC gamma 2 (PLCG2) |
| Target Synonyms | FCAS3; APLAID; PLC-IV; PLC-gamma-2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW 264.7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 701-800 of PLC gamma 2 (PLCG2) (NP_002652.2) | Immunogen Sequence | HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVS |
|---|---|---|---|
| Uniprot ID | P16885 |
Uniprot Id
P16885
Target Species
Human
Target Name
PLCG2
Target Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
Target Function
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. It is a crucial enzyme in transmembrane signaling.
Target Involvement
Familial cold autoinflammatory syndrome 3 (FCAS3); Autoinflammation, antibody deficiency, and immune dysregulation PLCG2-associated (APLAID)
Target Synonyms
1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 2; 1-phosphatidylinositol-4; 5-bisphosphate phosphodiesterase gamma-2; EC 3.1.4.11; Phosphoinositide phospholipase C; Phosphoinositide phospholipase C-gamma-2; Phospholipase C gamma 2; Phospholipase C, gamma 2 (phosphatidylinositol specific); Phospholipase C-gamma-2; Phospholipase C-IV; PLC 2; PLC gamma 2; PLC IV; PLC-gamma-2; PLC-IV; Plcg2; PLCG2_HUMAN
Target Background
The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4, 5-bisphosphate to 1D-myo-inositol 1, 4, 5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
