Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Defb26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against Defb26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of U2OS cells using Defb26 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
| Cat.No | ADA-00109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Defb26 |
| Target Synonyms | DEFB126; C20orf8; DEFB-26; DEFB26; HBD26; bA530N10.1; hBD-26; Defb26 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1). | Target Species | Rat |
|---|---|---|---|
| Immunogen Sequence | WRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP | Uniprot ID | Q32ZG6 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
